PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 290aa    MW: 32617.6 Da    PI: 8.114
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0282genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Gh_A11G0282 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.17.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_A11G0282  67 RGNFTEEEEKTIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.328961IPR017930Myb domain
SuperFamilySSF466896.11E-3111108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002492.7E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-241568IPR009057Homeodomain-like
CDDcd001674.39E-111661No hitNo description
PROSITE profilePS5129425.47462116IPR017930Myb domain
SMARTSM007173.3E-1666114IPR001005SANT/Myb domain
PfamPF002494.9E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2569117IPR009057Homeodomain-like
CDDcd001671.44E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEEEEKTIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKGQ  120
NQDGVSYCQS VPKGQWERRL QTDIRMAKQA LSEALSLRKQ NPSTDSNDFN DLLNSAQPHQ  180
PPTYASSADN ISRLLQNWMK NTPKPASATA AANSAETMTR SSFNSNDEGA LSDKGLDSFF  240
SFNSSSTCSD NDVSLESENS VVFQVESKPN MGDQMPLTLI EKWLLDDVLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488913.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-127MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B0NG300.0A0A0B0NG30_G
STRINGSolyc03g116100.2.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-103myb domain protein 96